Text mining Term | tumor suppressor p53 |
---|---|
UniProt ID | P53_MOUSE |
Name |
Cellular tumor antigen p53 Tumor suppressor p53 |
Gene Names |
Tp53
|
Taxonomy | Mus musculus |
Function |
Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression (By similarity). |
---|---|
Subcellular location |
Cytoplasm (By similarity). Nucleus (By similarity). Endoplasmic reticulum (By similarity). Nucleus, PML body (By similarity). Note=Interaction with BANP promotes nuclear localization. Recruited into PML bodies together with CHEK2 (By similarity). |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | BP |
GO:0008156 | negative regulation of DNA replication | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0051276 | chromosome organization | BP |
GO:0000739 | DNA strand annealing activity | MF |
GO:0006289 | nucleotide-excision repair | BP |
GO:0000060 | protein import into nucleus, translocation | BP |
GO:0034644 | cellular response to UV | BP |
GO:0043066 | negative regulation of apoptotic process | BP |
GO:0002326 | B cell lineage commitment | BP |
GO:0031065 | positive regulation of histone deacetylation | BP |
GO:0005657 | replication fork | CC |
GO:0070245 | positive regulation of thymocyte apoptosis | BP |
GO:0035033 | histone deacetylase regulator activity | MF |
GO:0001701 | in utero embryonic development | BP |
GO:0002039 | p53 binding | MF |
GO:0007406 | negative regulation of neuroblast proliferation | BP |
GO:0002309 | T cell proliferation involved in immune response | BP |
GO:0043565 | sequence-specific DNA binding | MF |
GO:0008340 | determination of adult lifespan | BP |
GO:0010165 | response to X-ray | BP |
GO:0042493 | response to drug | BP |
GO:0000785 | chromatin | CC |
GO:0005507 | copper ion binding | MF |
GO:0010332 | response to gamma radiation | BP |
GO:0016605 | PML body | CC |
GO:0030308 | negative regulation of cell growth | BP |
GO:0001077 | RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription | MF |
GO:0035264 | multicellular organism growth | BP |
GO:0007049 | cell cycle | BP |
GO:0033077 | T cell differentiation in thymus | BP |
GO:0003684 | damaged DNA binding | MF |
GO:0002360 | T cell lineage commitment | BP |
GO:0007417 | central nervous system development | BP |
GO:0048147 | negative regulation of fibroblast proliferation | BP |
GO:0005667 | transcription factor complex | CC |
GO:0044212 | transcription regulatory region DNA binding | MF |
GO:0006977 | DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest | BP |
GO:0042771 | DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis | BP |
GO:0006302 | double-strand break repair | BP |
GO:0008635 | activation of caspase activity by cytochrome c | BP |
GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway | BP |
GO:0005730 | nucleolus | CC |
GO:0001836 | release of cytochrome c from mitochondria | BP |
GO:0007369 | gastrulation | BP |
GO:0005524 | ATP binding | MF |
GO:0003682 | chromatin binding | MF |
GO:0006978 | DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator | BP |
GO:0051262 | protein tetramerization | BP |
GO:0007569 | cell aging | BP |
GO:0090343 | positive regulation of cell aging | BP |
GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | BP |
GO:0005739 | mitochondrion | CC |
GO:0046902 | regulation of mitochondrial membrane permeability | BP |
GO:0070215 | MDM2 binding | MF |
GO:0001756 | somitogenesis | BP |
GO:0005829 | cytosol | CC |
GO:0009303 | rRNA transcription | BP |
GO:0043525 | positive regulation of neuron apoptosis | BP |
>gi|187960040|ref|NP_001120705.1| cellular tumor antigen p53 isoform b [Mus musculus] MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQ DPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPV QLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFR HSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRR TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDA HATEESGDSRAHSSLQPRAFQALIKEESPNC |
Ensembl Gene |
ENSMUST00000005371 |
---|---|
UniGene |
Mm.222 |
PDB |
2P52 1HU8 3EXL 2IOM 2IOI 2GEQ 3EXJ 2IOO |
RefSeq |
NP_035770.2 NP_001120705.1 |
Pfam |
PF07710 PF08563 PF00870 |