Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HO-1 HSP32 Heme oxygenase 1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0005730 | nucleolus | CC |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0006644 | phospholipid metabolic process | BP |
GO:0008219 | cell death | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0005901 | caveola | CC |
GO:0020037 | heme binding | MF |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0001525 | angiogenesis | BP |
GO:0001666 | response to hypoxia | BP |
GO:0006788 | heme oxidation | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0042167 | heme catabolic process | BP |
GO:0005829 | cytosol | CC |
GO:0008217 | regulation of blood pressure | BP |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0031670 | cellular response to nutrient | BP |
GO:0019899 | enzyme binding | MF |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0004630 | phospholipase D activity | MF |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0005792 | microsome | CC |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1DVE 1J2C 3I9U 1J02 1IX3 1VGI 1IVJ 2DY5 1ULX 1IRM 1DVG 3I9T 2E7E 2ZVU 1UBB 1IX4 |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |