Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
Heme oxygenase 1 HSP32 HO-1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0008219 | cell death | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0001525 | angiogenesis | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0005792 | microsome | CC |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0042167 | heme catabolic process | BP |
GO:0006644 | phospholipid metabolic process | BP |
GO:0001666 | response to hypoxia | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0005901 | caveola | CC |
GO:0031670 | cellular response to nutrient | BP |
GO:0005829 | cytosol | CC |
GO:0008217 | regulation of blood pressure | BP |
GO:0020037 | heme binding | MF |
GO:0006788 | heme oxidation | BP |
GO:0019899 | enzyme binding | MF |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0005730 | nucleolus | CC |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0043305 | negative regulation of mast cell degranulation | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1DVE 2DY5 1J02 2ZVU 1IX3 1ULX 3I9U 1DVG 3I9T 1J2C 1IVJ 1VGI 1UBB 1IRM 2E7E 1IX4 |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |