Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
Heme oxygenase 1 HO-1 HSP32 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0019899 | enzyme binding | MF |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0001525 | angiogenesis | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0008219 | cell death | BP |
GO:0006644 | phospholipid metabolic process | BP |
GO:0005901 | caveola | CC |
GO:0005783 | endoplasmic reticulum | CC |
GO:0043627 | response to estrogen stimulus | BP |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0020037 | heme binding | MF |
GO:0005730 | nucleolus | CC |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0005829 | cytosol | CC |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0042167 | heme catabolic process | BP |
GO:0031670 | cellular response to nutrient | BP |
GO:0001666 | response to hypoxia | BP |
GO:0006788 | heme oxidation | BP |
GO:0005792 | microsome | CC |
GO:0008217 | regulation of blood pressure | BP |
GO:0004630 | phospholipase D activity | MF |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1IVJ 2ZVU 1UBB 1IRM 1J02 1ULX 3I9T 1IX4 2E7E 3I9U 1DVE 1DVG 1J2C 2DY5 1VGI 1IX3 |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |