Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HO-1 Heme oxygenase 1 HSP32 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0008219 | cell death | BP |
GO:0042167 | heme catabolic process | BP |
GO:0006644 | phospholipid metabolic process | BP |
GO:0001666 | response to hypoxia | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0020037 | heme binding | MF |
GO:0008217 | regulation of blood pressure | BP |
GO:0006788 | heme oxidation | BP |
GO:0005901 | caveola | CC |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0005792 | microsome | CC |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0031670 | cellular response to nutrient | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0001525 | angiogenesis | BP |
GO:0019899 | enzyme binding | MF |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0005783 | endoplasmic reticulum | CC |
GO:0005730 | nucleolus | CC |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0005829 | cytosol | CC |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1ULX 2ZVU 1UBB 2E7E 1IX4 1J2C 1DVE 1VGI 1IVJ 1IRM 1DVG 3I9U 3I9T 1J02 1IX3 2DY5 |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |