Text mining Term | neurokinin 1 receptor |
---|---|
UniProt ID | NK1R_RAT |
Name |
NK-1 receptor SPR NK-1R Tachykinin receptor 1 Substance-P receptor |
Gene Names |
Tacr1
Synonyms:Tac1r |
Taxonomy | Rattus norvegicus |
Function |
This is a receptor for the tachykinin neuropeptide substance P. It is probably associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance P > substance K > neuromedin-K. |
---|---|
Subcellular location |
Cell membrane; Multi-pass membrane protein. |
GO:0032230 | positive regulation of synaptic transmission, GABAergic | BP |
GO:0016021 | integral to membrane | CC |
GO:0032224 | positive regulation of synaptic transmission, cholinergic | BP |
GO:0048266 | behavioral response to pain | BP |
GO:0050671 | positive regulation of lymphocyte proliferation | BP |
GO:0048660 | regulation of smooth muscle cell proliferation | BP |
GO:0070474 | positive regulation of uterine smooth muscle contraction | BP |
GO:0008306 | associative learning | BP |
GO:0046887 | positive regulation of hormone secretion | BP |
GO:0030425 | dendrite | CC |
GO:0043117 | positive regulation of vascular permeability | BP |
GO:0010996 | response to auditory stimulus | BP |
GO:0045907 | positive regulation of vasoconstriction | BP |
GO:0007204 | elevation of cytosolic calcium ion concentration | BP |
GO:0003051 | angiotensin-mediated drinking behavior | BP |
GO:0045471 | response to ethanol | BP |
GO:0044297 | cell body | CC |
GO:0019233 | sensory perception of pain | BP |
GO:0042713 | sperm ejaculation | BP |
GO:0005624 | membrane fraction | CC |
GO:0007616 | long-term memory | BP |
GO:0046878 | positive regulation of saliva secretion | BP |
GO:0010634 | positive regulation of epithelial cell migration | BP |
GO:0005737 | cytoplasm | CC |
GO:0002687 | positive regulation of leukocyte migration | BP |
GO:0050679 | positive regulation of epithelial cell proliferation | BP |
GO:0035815 | positive regulation of renal sodium excretion | BP |
GO:0051496 | positive regulation of stress fiber assembly | BP |
GO:0035094 | response to nicotine | BP |
GO:0060083 | smooth muscle contraction involved in micturition | BP |
GO:0005886 | plasma membrane | CC |
GO:0002526 | acute inflammatory response | BP |
GO:0045760 | positive regulation of action potential | BP |
GO:0010193 | response to ozone | BP |
GO:0032570 | response to progesterone stimulus | BP |
GO:0032355 | response to estradiol stimulus | BP |
GO:0043278 | response to morphine | BP |
GO:0016496 | substance P receptor activity | MF |
GO:0002118 | aggressive behavior | BP |
GO:0045777 | positive regulation of blood pressure | BP |
GO:0009408 | response to heat | BP |
GO:0042755 | eating behavior | BP |
GO:0014910 | regulation of smooth muscle cell migration | BP |
GO:0035106 | operant conditioning | BP |
GO:0009986 | cell surface | CC |
>gi|6981628|ref|NP_036799.1| substance-P receptor [Rattus norvegicus] MDNVLPMDSDLFPNISTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAHKRMRTVTNYF LVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASIYSMTAVAFDRYMAIIHPLQP RLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNRTYEKAYHICVTVLIYFLPLL VIGYAYTVVGITLWASEIPGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPFHVFFLLPYINPDLYLK KFIQQVYLASMWLAMSSTMYNPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQSSVYK VSRLETTISTVVGAHEEEPEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA |
Ensembl Gene |
ENSRNOT00000007984 |
---|---|
UniGene |
Rn.89609 |
PDB | |
RefSeq |
NP_036799.1 |
Pfam |
PF00001 |