Text mining Term | Ciliary neurotrophic factor |
---|---|
UniProt ID | CNTF_RAT |
Name |
Ciliary neurotrophic factor CNTF |
Gene Names |
Cntf
|
Taxonomy | Rattus norvegicus |
Function |
CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. |
---|---|
Subcellular location |
Cytoplasm. |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0043410 | positive regulation of MAPKKK cascade | BP |
GO:0060081 | membrane hyperpolarization | BP |
GO:0005127 | ciliary neurotrophic factor receptor binding | MF |
GO:0043526 | neuroprotection | BP |
GO:0030424 | axon | CC |
GO:0014068 | positive regulation of phosphatidylinositol 3-kinase cascade | BP |
GO:0007259 | JAK-STAT cascade | BP |
GO:0008284 | positive regulation of cell proliferation | BP |
GO:0060075 | regulation of resting membrane potential | BP |
GO:0048680 | positive regulation of axon regeneration | BP |
GO:0032838 | cell projection cytoplasm | CC |
GO:0008083 | growth factor activity | MF |
GO:0043025 | neuronal cell body | CC |
GO:0040007 | growth | BP |
GO:0042517 | positive regulation of tyrosine phosphorylation of Stat3 protein | BP |
GO:0005125 | cytokine activity | MF |
GO:0005829 | cytosol | CC |
GO:0046887 | positive regulation of hormone secretion | BP |
GO:0030307 | positive regulation of cell growth | BP |
GO:0048143 | astrocyte activation | BP |
GO:0005634 | nucleus | CC |
>gi|6978675|ref|NP_037298.1| ciliary neurotrophic factor [Rattus norvegicus] MAFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEA ERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEAD GMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM |
Ensembl Gene | |
---|---|
UniGene |
Rn.6067 |
PDB | |
RefSeq |
NP_037298.1 |
Pfam |
PF01110 |