Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
BDNF Brain-derived neurotrophic factor |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0030182 | neuron differentiation | BP |
GO:0042493 | response to drug | BP |
GO:0014076 | response to fluoxetine | BP |
GO:0072347 | response to anesthetic | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0005576 | extracellular region | CC |
GO:0002544 | chronic inflammatory response | BP |
GO:0008083 | growth factor activity | MF |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0050890 | cognition | BP |
GO:0009725 | response to hormone stimulus | BP |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0033189 | response to vitamin A | BP |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
GO:0001666 | response to hypoxia | BP |
GO:0008021 | synaptic vesicle | CC |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |