Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
BDNF Brain-derived neurotrophic factor |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0005576 | extracellular region | CC |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0042493 | response to drug | BP |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0072347 | response to anesthetic | BP |
GO:0030182 | neuron differentiation | BP |
GO:0008083 | growth factor activity | MF |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
GO:0001666 | response to hypoxia | BP |
GO:0050890 | cognition | BP |
GO:0033189 | response to vitamin A | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0008021 | synaptic vesicle | CC |
GO:0014076 | response to fluoxetine | BP |
GO:0009725 | response to hormone stimulus | BP |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0002544 | chronic inflammatory response | BP |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |