Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
BDNF Brain-derived neurotrophic factor |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0009725 | response to hormone stimulus | BP |
GO:0002544 | chronic inflammatory response | BP |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0001666 | response to hypoxia | BP |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0008021 | synaptic vesicle | CC |
GO:0005576 | extracellular region | CC |
GO:0030182 | neuron differentiation | BP |
GO:0072347 | response to anesthetic | BP |
GO:0014076 | response to fluoxetine | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0008083 | growth factor activity | MF |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0042493 | response to drug | BP |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0050890 | cognition | BP |
GO:0033189 | response to vitamin A | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |