Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
BDNF Brain-derived neurotrophic factor |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0050890 | cognition | BP |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0072347 | response to anesthetic | BP |
GO:0042493 | response to drug | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0009725 | response to hormone stimulus | BP |
GO:0008083 | growth factor activity | MF |
GO:0008021 | synaptic vesicle | CC |
GO:0002544 | chronic inflammatory response | BP |
GO:0033189 | response to vitamin A | BP |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
GO:0014076 | response to fluoxetine | BP |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0001666 | response to hypoxia | BP |
GO:0005576 | extracellular region | CC |
GO:0030182 | neuron differentiation | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |