Text mining Term | erythropoietin |
---|---|
UniProt ID | EPO_RAT |
Name |
Erythropoietin |
Gene Names |
Epo
|
Taxonomy | Rattus norvegicus |
Function |
Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. |
---|---|
Subcellular location |
Secreted. |
GO:0005615 | extracellular space | CC |
GO:0033574 | response to testosterone stimulus | BP |
GO:0043249 | erythrocyte maturation | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0070555 | response to interleukin-1 | BP |
GO:0009651 | response to salt stress | BP |
GO:0001666 | response to hypoxia | BP |
GO:0045666 | positive regulation of neuron differentiation | BP |
GO:0005179 | hormone activity | MF |
GO:0051602 | response to electrical stimulus | BP |
GO:0007568 | aging | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0005128 | erythropoietin receptor binding | MF |
GO:0043526 | neuroprotection | BP |
GO:0033189 | response to vitamin A | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0048678 | response to axon injury | BP |
>gi|8393316|ref|NP_058697.1| erythropoietin precursor [Rattus norvegicus] MGVPERPTLLLLLSLLLIPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDT KVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLHIDKAISGLRSLTSLLRVLGA QKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR |
Ensembl Gene |
ENSRNOT00000001914 |
---|---|
UniGene |
Rn.11365 |
PDB | |
RefSeq |
NP_058697.1 |
Pfam |
PF00758 |