Text mining Term | survivin |
---|---|
UniProt ID | BIRC5_MOUSE |
Name |
Apoptosis inhibitor 4 Baculoviral IAP repeat-containing protein 5 Apoptosis inhibitor survivin TIAP |
Gene Names |
Birc5
|
Taxonomy | Mus musculus |
Function |
Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May play a role in neoplasia. May counteract a default induction of apoptosis in G2/M phase. Inhibitor of caspase-3 and caspase-7 (By similarity). |
---|---|
Subcellular location |
Cytoplasm (By similarity). Nucleus (By similarity). Chromosome, centromere (By similarity). Cytoplasm, cytoskeleton, spindle (By similarity). Note=Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalizes with AURKB at mitotic chromosomes (By similarity). |
GO:0032133 | chromosome passenger complex | CC |
GO:0031503 | protein complex localization | BP |
GO:0005829 | cytosol | CC |
GO:0005881 | cytoplasmic microtubule | CC |
GO:0008017 | microtubule binding | MF |
GO:0007067 | mitosis | BP |
GO:0031577 | spindle checkpoint | BP |
GO:0000086 | G2/M transition of mitotic cell cycle | BP |
GO:0000775 | chromosome, centromeric region | CC |
GO:0042803 | protein homodimerization activity | MF |
GO:0005814 | centriole | CC |
GO:0000910 | cytokinesis | BP |
GO:0000226 | microtubule cytoskeleton organization | BP |
GO:0007059 | chromosome segregation | BP |
GO:0051303 | establishment of chromosome localization | BP |
GO:0045931 | positive regulation of mitotic cell cycle | BP |
GO:0031021 | interphase microtubule organizing center | CC |
GO:0006916 | anti-apoptosis | BP |
GO:0005634 | nucleus | CC |
GO:0031536 | positive regulation of exit from mitosis | BP |
GO:0005876 | spindle microtubule | CC |
GO:0008270 | zinc ion binding | MF |
GO:0048037 | cofactor binding | MF |
GO:0043027 | cysteine-type endopeptidase inhibitor activity involved in apoptotic process | MF |
GO:0030496 | midbody | CC |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0009790 | embryo development | BP |
>gi|59859890|ref|NP_001012273.1| baculoviral IAP repeat-containing protein 5 isoform 3 [Mus musculus] MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPD DNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIVCMIENKD |
Ensembl Gene |
ENSMUST00000106322 ENSMUST00000093906 ENSMUST00000081387 |
---|---|
UniGene |
Mm.8552 |
PDB |
1M4M |
RefSeq |
NP_001012273.1 NP_033819.1 |
Pfam |
PF00653 |