Text mining Term | osteonectin |
---|---|
UniProt ID | SPRC_RAT |
Name |
ON SPARC Osteonectin BM-40 Basement-membrane protein 40 Secreted protein acidic and rich in cysteine |
Gene Names |
Sparc
|
Taxonomy | Rattus norvegicus |
Function |
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
---|---|
Subcellular location |
Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane (By similarity). |
GO:0048839 | inner ear development | BP |
GO:0007165 | signal transduction | BP |
GO:0030324 | lung development | BP |
GO:0005509 | calcium ion binding | MF |
GO:0005604 | basement membrane | CC |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0051591 | response to cAMP | BP |
GO:0005634 | nucleus | CC |
GO:0010288 | response to lead ion | BP |
GO:0005615 | extracellular space | CC |
GO:0034097 | response to cytokine stimulus | BP |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0033591 | response to L-ascorbic acid | BP |
GO:0001503 | ossification | BP |
GO:0046686 | response to cadmium ion | BP |
GO:0007507 | heart development | BP |
GO:0045471 | response to ethanol | BP |
GO:0051592 | response to calcium ion | BP |
GO:0031988 | membrane-bounded vesicle | CC |
GO:0005737 | cytoplasm | CC |
GO:0042060 | wound healing | BP |
GO:0009629 | response to gravity | BP |
GO:0043434 | response to peptide hormone stimulus | BP |
>gi|6981574|ref|NP_036788.1| SPARC precursor [Rattus norvegicus] MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPC QNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLH LDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHP VELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIA LEEWAGCFGIKEQDINKDLVI |
Ensembl Gene |
ENSRNOT00000017486 |
---|---|
UniGene |
Rn.98989 |
PDB | |
RefSeq |
NP_036788.1 |
Pfam |
PF10591 PF00050 PF09289 |