Text mining Term | osteonectin |
---|---|
UniProt ID | SPRC_RAT |
Name |
Basement-membrane protein 40 Secreted protein acidic and rich in cysteine BM-40 Osteonectin SPARC ON |
Gene Names |
Sparc
|
Taxonomy | Rattus norvegicus |
Function |
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
---|---|
Subcellular location |
Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane (By similarity). |
GO:0046686 | response to cadmium ion | BP |
GO:0043434 | response to peptide hormone stimulus | BP |
GO:0042060 | wound healing | BP |
GO:0005634 | nucleus | CC |
GO:0051592 | response to calcium ion | BP |
GO:0001503 | ossification | BP |
GO:0005509 | calcium ion binding | MF |
GO:0048839 | inner ear development | BP |
GO:0005615 | extracellular space | CC |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0007165 | signal transduction | BP |
GO:0034097 | response to cytokine stimulus | BP |
GO:0007507 | heart development | BP |
GO:0005604 | basement membrane | CC |
GO:0031988 | membrane-bounded vesicle | CC |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0033591 | response to L-ascorbic acid | BP |
GO:0030324 | lung development | BP |
GO:0009629 | response to gravity | BP |
GO:0051591 | response to cAMP | BP |
GO:0010288 | response to lead ion | BP |
GO:0005737 | cytoplasm | CC |
GO:0045471 | response to ethanol | BP |
>gi|6981574|ref|NP_036788.1| SPARC precursor [Rattus norvegicus] MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPC QNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLH LDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHP VELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIA LEEWAGCFGIKEQDINKDLVI |
Ensembl Gene |
ENSRNOT00000017486 |
---|---|
UniGene |
Rn.98989 |
PDB | |
RefSeq |
NP_036788.1 |
Pfam |
PF10591 PF00050 PF09289 |