monocyte chemoattractant protein 1

General Information (Source: NCBI Gene,UniProt)

Text mining Term monocyte chemoattractant protein 1
UniProt ID CCL2_RAT
Name Immediate-early serum-responsive protein JE
MCP-1
Small-inducible cytokine A2
Monocyte chemoattractant protein 1
C-C motif chemokine 2
Monocyte chemotactic protein 1
Gene Names Ccl2
Taxonomy Rattus norvegicus

General annotation

Function Chemotactic factor that attracts monocytes, but not neutrophils.
Subcellular location Secreted.

Gene Ontology

GO:0032570 response to progesterone stimulus BP
GO:0007568 aging BP
GO:0008009 chemokine activity MF
GO:0051384 response to glucocorticoid stimulus BP
GO:0001938 positive regulation of endothelial cell proliferation BP
GO:0046677 response to antibiotic BP
GO:0042466 chemokinesis BP
GO:0045471 response to ethanol BP
GO:0007179 transforming growth factor beta receptor signaling pathway BP
GO:0005615 extracellular space CC
GO:0060137 maternal process involved in parturition BP
GO:0042493 response to drug BP
GO:0010332 response to gamma radiation BP
GO:0009612 response to mechanical stimulus BP
GO:0050806 positive regulation of synaptic transmission BP
GO:0014823 response to activity BP
GO:0033552 response to vitamin B3 BP
GO:0031727 CCR2 chemokine receptor binding MF
GO:0005737 cytoplasm CC
GO:0009408 response to heat BP
GO:0070098 chemokine-mediated signaling pathway BP
GO:0048247 lymphocyte chemotaxis BP
GO:0006874 cellular calcium ion homeostasis BP
GO:0006954 inflammatory response BP
GO:0030593 neutrophil chemotaxis BP
GO:0043025 neuronal cell body CC
GO:0048246 macrophage chemotaxis BP
GO:0043200 response to amino acid stimulus BP
GO:0031100 organ regeneration BP
GO:0048010 vascular endothelial growth factor receptor signaling pathway BP
GO:0001666 response to hypoxia BP
GO:0008201 heparin binding MF

Sequence

>gi|13928714|ref|NP_113718.1| C-C motif chemokine 2 [Rattus norvegicus]
MQVSVTLLGLLFTVAACSIHVLSQPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKL
KREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSV
EVTSMTEN

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000009448
UniGene Rn.4772
PDB
RefSeq NP_113718.1
Pfam PF00048