bone morphogenetic protein 2

General Information (Source: NCBI Gene,UniProt)

Text mining Term bone morphogenetic protein 2
UniProt ID BMP2_MOUSE
Name Bone morphogenetic protein 2
Bone morphogenetic protein 2A
BMP-2A
BMP-2
Gene Names Bmp2
Taxonomy Mus musculus

General annotation

Function Induces cartilage and bone formation.
Subcellular location Secreted.

Gene Ontology

GO:0060128 corticotropin hormone secreting cell differentiation BP
GO:0042475 odontogenesis of dentin-containing tooth BP
GO:0060129 thyroid-stimulating hormone-secreting cell differentiation BP
GO:0010718 positive regulation of epithelial to mesenchymal transition BP
GO:0007179 transforming growth factor beta receptor signaling pathway BP
GO:0001701 in utero embryonic development BP
GO:0000122 negative regulation of transcription from RNA polymerase II promoter BP
GO:0042482 positive regulation of odontogenesis BP
GO:0030335 positive regulation of cell migration BP
GO:0035054 embryonic heart tube anterior/posterior pattern specification BP
GO:0005125 cytokine activity MF
GO:0060039 pericardium development BP
GO:0060395 SMAD protein signal transduction BP
GO:0004745 retinol dehydrogenase activity MF
GO:0061036 positive regulation of cartilage development BP
GO:0003181 atrioventricular valve morphogenesis BP
GO:0040007 growth BP
GO:0001658 branching involved in ureteric bud morphogenesis BP
GO:0021978 telencephalon regionalization BP
GO:0071407 cellular response to organic cyclic compound BP
GO:0051216 cartilage development BP
GO:0001649 osteoblast differentiation BP
GO:0055008 cardiac muscle tissue morphogenesis BP
GO:0005615 extracellular space CC
GO:0045666 positive regulation of neuron differentiation BP
GO:0048711 positive regulation of astrocyte differentiation BP
GO:0045944 positive regulation of transcription from RNA polymerase II promoter BP
GO:0031648 protein destabilization BP
GO:0033690 positive regulation of osteoblast proliferation BP
GO:0008285 negative regulation of cell proliferation BP
GO:0010862 positive regulation of pathway-restricted SMAD protein phosphorylation BP
GO:0003203 endocardial cushion morphogenesis BP
GO:0007219 Notch signaling pathway BP
GO:0008083 growth factor activity MF
GO:0071363 cellular response to growth factor stimulus BP
GO:0045600 positive regulation of fat cell differentiation BP
GO:0001666 response to hypoxia BP
GO:0060804 positive regulation of Wnt receptor signaling pathway by BMP signaling pathway BP
GO:0006954 inflammatory response BP
GO:0045669 positive regulation of osteoblast differentiation BP

Sequence

>gi|71896669|ref|NP_031579.2| bone morphogenetic protein 2 precursor [Mus musculus]
MVAGTRCLLVLLLPQVLLGGAAGLIPELGRKKFAAASSRPLSRPSEDVLSEFELRLLSMFGLKQRPTPSK
DVVVPPYMLDLYRRHSGQPGAPAPDHRLERAASRANTVRSFHHEEAVEELPEMSGKTARRFFFNLSSVPS
DEFLTSAELQIFREQIQEALGNSSFQHRINIYEIIKPAAANLKFPVTRLLDTRLVNQNTSQWESFDVTPA
VMRWTTQGHTNHGFVVEVAHLEENPGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKR
QAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSV
NSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSMUST00000028836
UniGene Mm.103205
PDB
RefSeq NP_031579.2
Pfam PF00688
PF00019