cystatin C

General Information (Source: NCBI Gene,UniProt)

Text mining Term cystatin C
UniProt ID CYTC_RAT
Name Cystatin-C
Cystatin-3
Gene Names Cst3
Taxonomy Rattus norvegicus

General annotation

Function As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity. Known to inhibits cathepsin B, H, and L.
Subcellular location Secreted.

Gene Ontology

GO:0007566 embryo implantation BP
GO:0005771 multivesicular body CC
GO:0005783 endoplasmic reticulum CC
GO:0031965 nuclear membrane CC
GO:0008284 positive regulation of cell proliferation BP
GO:0014070 response to organic cyclic compound BP
GO:0009743 response to carbohydrate stimulus BP
GO:0033267 axon part CC
GO:0005615 extracellular space CC
GO:0007431 salivary gland development BP
GO:0070301 cellular response to hydrogen peroxide BP
GO:0009636 response to toxin BP
GO:0001666 response to hypoxia BP
GO:0032355 response to estradiol stimulus BP
GO:0043292 contractile fiber CC
GO:0043067 regulation of programmed cell death BP
GO:0031982 vesicle CC
GO:0060009 Sertoli cell development BP
GO:0045740 positive regulation of DNA replication BP
GO:0031667 response to nutrient levels BP
GO:0042493 response to drug BP
GO:0005764 lysosome CC
GO:0004869 cysteine-type endopeptidase inhibitor activity MF
GO:0043025 neuronal cell body CC
GO:0048471 perinuclear region of cytoplasm CC
GO:0006915 apoptotic process BP
GO:0060548 negative regulation of cell death BP
GO:0007420 brain development BP
GO:0048678 response to axon injury BP
GO:0005604 basement membrane CC
GO:0001654 eye development BP
GO:0001775 cell activation BP
GO:0042747 circadian sleep/wake cycle, REM sleep BP
GO:0002020 protease binding MF

Sequence

>gi|54234046|ref|NP_036969.1| cystatin-C precursor [Rattus norvegicus]
MASPLRSLMLLLAVLAVAWAGTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVV
RARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQIYSVPWKGTHTLTKSSCKNA

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000007175
UniGene Rn.106351
PDB
RefSeq NP_036969.1
Pfam PF00031