thioredoxin

General Information (Source: NCBI Gene,UniProt)

Text mining Term thioredoxin
UniProt ID THIO_RAT
Name Thioredoxin
Trx
Gene Names Txn
Synonyms:Txn1
Taxonomy Rattus norvegicus

General annotation

Function Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions (By similarity). Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity (By similarity).
Subcellular location Nucleus (By similarity). Cytoplasm (By similarity). Secreted (By similarity). Note=Secreted by a leaderless secretory pathway. Predominantly in the cytoplasm in non irradiated cells. Radiation induces translocation of TRX from the cytoplasm to the nucleus (By similarity).

Gene Ontology

GO:0004791 thioredoxin-disulfide reductase activity MF
GO:0048678 response to axon injury BP
GO:0033158 regulation of protein import into nucleus, translocation BP
GO:0071333 cellular response to glucose stimulus BP
GO:0030424 axon CC
GO:0022900 electron transport chain BP
GO:0043025 neuronal cell body CC
GO:0030425 dendrite CC
GO:0006662 glycerol ether metabolic process BP
GO:0006810 transport BP
GO:0071548 response to dexamethasone stimulus BP
GO:0005634 nucleus CC
GO:0097068 response to thyroxine stimulus BP
GO:0006351 transcription, DNA-dependent BP
GO:0010269 response to selenium ion BP
GO:0071455 cellular response to hyperoxia BP
GO:0016999 antibiotic metabolic process BP
GO:0019899 enzyme binding MF
GO:0005576 extracellular region CC
GO:0009055 electron carrier activity MF
GO:0015035 protein disulfide oxidoreductase activity MF
GO:0014823 response to activity BP
GO:0005829 cytosol CC
GO:0035690 cellular response to drug BP
GO:0006355 regulation of transcription, DNA-dependent BP
GO:0043388 positive regulation of DNA binding BP
GO:0009314 response to radiation BP

Sequence

>gi|16758644|ref|NP_446252.1| thioredoxin [Rattus norvegicus]
MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVDDCQDVAADCE
VKCMPTFQFYKKGQKVGEFSGANKEKLEATITEFA

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000016447
UniGene Rn.29777
PDB
RefSeq NP_446252.1
Pfam PF00085