peripheral type benzodiazepine receptor

General Information (Source: NCBI Gene,UniProt)

Text mining Term peripheral type benzodiazepine receptor
UniProt ID TSPO_RAT
Name PBR
Translocator protein
PKBS
Peripheral-type benzodiazepine receptor
Mitochondrial benzodiazepine receptor
Gene Names Tspo
Taxonomy Rattus norvegicus

General annotation

Function Responsible for the manifestation of peripheral-type benzodiazepine recognition sites and is most likely to comprise binding domains for benzodiazepines and isoquinoline carboxamides. May play a role in the transport of porphyrins and heme. Plays a role in the transport of cholesterol across mitochondrial membranes in steroidogenic cells (By similarity).
Subcellular location Mitochondrion membrane; Multi-pass membrane protein.

Gene Ontology

GO:0010042 response to manganese ion BP
GO:0005515 protein binding MF
GO:0071222 cellular response to lipopolysaccharide BP
GO:0016021 integral to membrane CC
GO:0071476 cellular hypotonic response BP
GO:0030325 adrenal gland development BP
GO:0051928 positive regulation of calcium ion transport BP
GO:0060252 positive regulation of glial cell proliferation BP
GO:0008503 benzodiazepine receptor activity MF
GO:0045019 negative regulation of nitric oxide biosynthetic process BP
GO:0043065 positive regulation of apoptotic process BP
GO:0014012 peripheral nervous system axon regeneration BP
GO:0071294 cellular response to zinc ion BP
GO:0060242 contact inhibition BP
GO:0050810 regulation of steroid biosynthetic process BP
GO:0010940 positive regulation of necrotic cell death BP
GO:0008347 glial cell migration BP
GO:0010266 response to vitamin B1 BP
GO:0060253 negative regulation of glial cell proliferation BP
GO:0032720 negative regulation of tumor necrosis factor production BP
GO:0048266 behavioral response to pain BP
GO:0006694 steroid biosynthetic process BP
GO:0033574 response to testosterone stimulus BP
GO:0042493 response to drug BP
GO:0005741 mitochondrial outer membrane CC
GO:2000379 positive regulation of reactive oxygen species metabolic process BP
GO:0007568 aging BP
GO:0005497 androgen binding MF
GO:0051901 positive regulation of mitochondrial depolarization BP
GO:0032570 response to progesterone stimulus BP

Sequence

>gi|6978575|ref|NP_036647.1| translocator protein [Rattus norvegicus]
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKE
LGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPY
LAWLAFATMLNYYVWRDNSGRRGGSRLTE

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000014089
UniGene Rn.1820
PDB
RefSeq NP_036647.1
Pfam PF03073