Text mining Term | peripheral type benzodiazepine receptor |
---|---|
UniProt ID | TSPO_RAT |
Name |
PBR Translocator protein PKBS Peripheral-type benzodiazepine receptor Mitochondrial benzodiazepine receptor |
Gene Names |
Tspo
|
Taxonomy | Rattus norvegicus |
Function |
Responsible for the manifestation of peripheral-type benzodiazepine recognition sites and is most likely to comprise binding domains for benzodiazepines and isoquinoline carboxamides. May play a role in the transport of porphyrins and heme. Plays a role in the transport of cholesterol across mitochondrial membranes in steroidogenic cells (By similarity). |
---|---|
Subcellular location |
Mitochondrion membrane; Multi-pass membrane protein. |
GO:0010042 | response to manganese ion | BP |
GO:0005515 | protein binding | MF |
GO:0071222 | cellular response to lipopolysaccharide | BP |
GO:0016021 | integral to membrane | CC |
GO:0071476 | cellular hypotonic response | BP |
GO:0030325 | adrenal gland development | BP |
GO:0051928 | positive regulation of calcium ion transport | BP |
GO:0060252 | positive regulation of glial cell proliferation | BP |
GO:0008503 | benzodiazepine receptor activity | MF |
GO:0045019 | negative regulation of nitric oxide biosynthetic process | BP |
GO:0043065 | positive regulation of apoptotic process | BP |
GO:0014012 | peripheral nervous system axon regeneration | BP |
GO:0071294 | cellular response to zinc ion | BP |
GO:0060242 | contact inhibition | BP |
GO:0050810 | regulation of steroid biosynthetic process | BP |
GO:0010940 | positive regulation of necrotic cell death | BP |
GO:0008347 | glial cell migration | BP |
GO:0010266 | response to vitamin B1 | BP |
GO:0060253 | negative regulation of glial cell proliferation | BP |
GO:0032720 | negative regulation of tumor necrosis factor production | BP |
GO:0048266 | behavioral response to pain | BP |
GO:0006694 | steroid biosynthetic process | BP |
GO:0033574 | response to testosterone stimulus | BP |
GO:0042493 | response to drug | BP |
GO:0005741 | mitochondrial outer membrane | CC |
GO:2000379 | positive regulation of reactive oxygen species metabolic process | BP |
GO:0007568 | aging | BP |
GO:0005497 | androgen binding | MF |
GO:0051901 | positive regulation of mitochondrial depolarization | BP |
GO:0032570 | response to progesterone stimulus | BP |
>gi|6978575|ref|NP_036647.1| translocator protein [Rattus norvegicus] MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKE LGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPY LAWLAFATMLNYYVWRDNSGRRGGSRLTE |
Ensembl Gene |
ENSRNOT00000014089 |
---|---|
UniGene |
Rn.1820 |
PDB | |
RefSeq |
NP_036647.1 |
Pfam |
PF03073 |