Text mining Term | epidermal growth factor |
---|---|
UniProt ID | EGFR_DROME |
Name |
Gurken receptor Drosophila relative of ERBB Protein torpedo Egfr Epidermal growth factor receptor |
Gene Names |
Egfr
|
Taxonomy | Drosophila melanogaster |
Function |
Binds to four ligands: Spitz, Gurken, Vein and Argos, which is an antagonist. Transduces the signal through the ras-raf- MAPK pathway. Involved in a myriad of developmental decisions. Critical for the proliferation of imaginal tissues, and for the determination of both the antero-posterior and dorso-ventral polarities of the oocyte. In the embryo, plays a role in the establishment of ventral cell fates, maintenance of amnioserosa and ventral neuroectodermal cells, germ band retraction, cell fate specification in the central nervous system and production of cuticle. |
---|---|
Subcellular location |
Membrane; Single-pass type I membrane protein. |
GO:0045749 | negative regulation of S phase of mitotic cell cycle | BP |
GO:0042676 | compound eye cone cell fate commitment | BP |
GO:0008586 | imaginal disc-derived wing vein morphogenesis | BP |
GO:0007421 | stomatogastric nervous system development | BP |
GO:0045610 | regulation of hemocyte differentiation | BP |
GO:0035202 | tracheal pit formation in open tracheal system | BP |
GO:0007298 | border follicle cell migration | BP |
GO:0007420 | brain development | BP |
GO:0008071 | maternal determination of dorsal/ventral axis, ovarian follicular epithelium, soma encoded | BP |
GO:0030718 | germ-line stem cell maintenance | BP |
GO:0035277 | spiracle morphogenesis, open tracheal system | BP |
GO:0007473 | wing disc proximal/distal pattern formation | BP |
GO:0045466 | R7 cell differentiation | BP |
GO:0005006 | epidermal growth factor-activated receptor activity | MF |
GO:0007474 | imaginal disc-derived wing vein specification | BP |
GO:0046845 | branched duct epithelial cell fate determination, open tracheal system | BP |
GO:0035160 | maintenance of epithelial integrity, open tracheal system | BP |
GO:0006916 | anti-apoptosis | BP |
GO:0007422 | peripheral nervous system development | BP |
GO:0048140 | male germ-line cyst encapsulation | BP |
GO:0016318 | ommatidial rotation | BP |
GO:0008406 | gonad development | BP |
GO:0007369 | gastrulation | BP |
GO:0016021 | integral to membrane | CC |
GO:0003015 | heart process | BP |
GO:0007479 | leg disc proximal/distal pattern formation | BP |
GO:0005886 | plasma membrane | CC |
GO:0007431 | salivary gland development | BP |
GO:0007458 | progression of morphogenetic furrow involved in compound eye morphogenesis | BP |
GO:0035225 | determination of genital disc primordium | BP |
GO:0008284 | positive regulation of cell proliferation | BP |
GO:0048139 | female germ-line cyst encapsulation | BP |
GO:0005524 | ATP binding | MF |
GO:0048149 | behavioral response to ethanol | BP |
GO:0016330 | second mitotic wave involved in compound eye morphogenesis | BP |
GO:0007390 | germ-band shortening | BP |
GO:0007391 | dorsal closure | BP |
GO:0046673 | negative regulation of compound eye retinal cell programmed cell death | BP |
GO:0000086 | G2/M transition of mitotic cell cycle | BP |
GO:0030381 | chorion-containing eggshell pattern formation | BP |
GO:0007455 | eye-antennal disc morphogenesis | BP |
GO:0042694 | muscle cell fate specification | BP |
GO:0007477 | notum development | BP |
GO:0001742 | oenocyte differentiation | BP |
GO:0007443 | Malpighian tubule morphogenesis | BP |
GO:0007314 | oocyte anterior/posterior axis specification | BP |
GO:0035088 | establishment or maintenance of apical/basal cell polarity | BP |
GO:0046843 | dorsal appendage formation | BP |
GO:0016203 | muscle attachment | BP |
GO:0030031 | cell projection assembly | BP |
GO:0007310 | oocyte dorsal/ventral axis specification | BP |
GO:0007482 | haltere development | BP |
GO:0016337 | cell-cell adhesion | BP |
GO:0007469 | antennal development | BP |
GO:0001752 | compound eye photoreceptor fate commitment | BP |
GO:0045468 | regulation of R8 cell spacing in compound eye | BP |
GO:0007367 | segment polarity determination | BP |
GO:0005515 | protein binding | MF |
GO:0035310 | notum cell fate specification | BP |
>gi|257471944|pdb|3I2T|A Chain A, Crystal Structure Of The Unliganded Drosophila Epidermal Growth Factor Receptor Ectodomain HHHHHHKICIGTKSRLSVPSNKEHHYRNLRDRYTNCTYVDGNLELTWLPNENLDLSFLDNIREVTGYILI SHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTYSKMYTLEIPDLRDVLNGQVGFHNNYNLCHMRTI QWSEIVSNGTDAYYNYDFTAPERECPKCHESCTHGCWGEGPKNCQKFSKLTCSPQCAGGRCYGPKPRECC HLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRD NGACVRSCPQDKMDKGGECVPCNGPCPKTCPGVTVLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYAN YTMGPRYIPLDPERLEVFSTVKEITGYLNIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKSSLY SLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNEDGCW GAGTDQCLNCKNFNFNGTCIADCGYISNAYKFDNRTCKICHPECRTCNGAGADHCQECVHV |
Ensembl Gene | |
---|---|
UniGene |
Dm.20748 |
PDB |
3LTG 3LTF 3I2T |
RefSeq |
NP_476759.1 |
Pfam |
PF01030 PF00757 PF07714 |