ATPase

General Information (Source: NCBI Gene,UniProt)

Text mining Term	ATPase
UniProt ID	ASNA_DROSI
Name	Arsenite-stimulated ATPase Arsenical pump-driving ATPase homolog ATPase ASNA1 homolog
Gene Names
Taxonomy	Drosophila simulans

General annotation

Function	ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors, where the tail- anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the membrane-bound receptor, and returning it to the cytosol to initiate a new round of targeting (By similarity).
Subcellular location	Cytoplasm (By similarity). Endoplasmic reticulum (By similarity).

Function

ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors, where the tail- anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the membrane-bound receptor, and returning it to the cytosol to initiate a new round of targeting (By similarity).

Subcellular location

Cytoplasm (By similarity). Endoplasmic reticulum (By similarity).

Gene Ontology

GO:0071722	detoxification of arsenic-containing substance	BP
GO:0046872	metal ion binding	MF
GO:0006810	transport	BP
GO:0005783	endoplasmic reticulum	CC
GO:0005524	ATP binding	MF
GO:0016887	ATPase activity	MF

Sequence

>gi|263406082|sp|B4QEC4.1|ASNA_DROSI RecName: Full=ATPase ASNA1 homolog; AltName: Full=Arsenical pump-driving ATPase homolog; AltName: Full=Arsenite-stimulated ATPase
MADNLEPLEPSLQNLVEQDSLKWIFVGGKGGVGKTTCSSSLAVQLSKVRESVLIISTDPAHNISDAFDQK
FTKVPTKVNGFDNLFAMEIDPNAGLNELPEEYFDGENEALRVSKGVMQEMINALPGIDEAMSYAEVMKLV
KGMNFSVVVFDTAPTGHTLRLIAFPQVVEKGLGKLLRLKMKVAPLLSQFVSMLGMADVNADTLSQKLDDM
LRVITQVNEQFKNPDQTTFVCVCIAEFFSLYETERLVQELTKCGIDVHNIIVNQLLFLQKSHDSCSMCAS
RFKIQEKYLDQIADLYEDFHVTKLPLLEKEVRGPESIRSFSENLMKPYDPKAEPKE

Database Cross Reference

Ensembl Gene
UniGene	Dsi.7305
PDB
RefSeq	XP_002080448.1
Pfam

PTID

ATPase

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference