Text mining Term | protein is |
---|---|
UniProt ID | CX5C2_HELAN |
Name |
Cytochrome c oxidase subunit 5C-2 Cytochrome c oxidase polypeptide Vc-2 |
Gene Names |
COX5C2
|
Taxonomy | Helianthus annuus |
Function |
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport (By similarity). |
---|---|
Subcellular location |
Mitochondrion inner membrane (By similarity). |
GO:0016021 | integral to membrane | CC |
GO:0005746 | mitochondrial respiratory chain | CC |
>gi|48428106|sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome c oxidase polypeptide Vc-2 MGGGRVAHPVLKGPSVVKELVIGTVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVVVDEE |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |