Text mining Term | protein is |
---|---|
UniProt ID | PSBJ_HORJU |
Name |
Photosystem II reaction center protein J PSII-J |
Gene Names |
psbJ
|
Taxonomy | Hordeum jubatum |
Function |
This protein is a component of the reaction center of photosystem II. |
---|---|
Subcellular location |
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein (By similarity). |
GO:0009539 | photosystem II reaction center | CC |
GO:0016021 | integral to membrane | CC |
GO:0015979 | photosynthesis | BP |
GO:0009535 | chloroplast thylakoid membrane | CC |
>gi|62287059|sp|Q6W6R2.1|PSBJ_HORJU RecName: Full=Photosystem II reaction center protein J; Short=PSII-J MADTTGRIPLWLIGTVAGIPVIGLVGVFFYGSYSGLGSSL |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |
PF01788 |